PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g36542.1.p
Common NameBRADI_1g36542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 662aa    MW: 72504.5 Da    PI: 5.4569
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g36542.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81.1e-17203250148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT++Ed++l+ +v+ +G g+W+ + r  g++R++k+c++rw ++l
  Bradi1g36542.1.p 203 KGPWTPDEDKRLKTYVEAHGEGNWNQVQRNAGLNRCGKSCRLRWANHL 250
                       79******************************************9986 PP

2Myb_DNA-binding45.51.8e-14256299146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++++eE++  +++++++G++ W++ a ++  gRt++++k++w++
  Bradi1g36542.1.p 256 KGPFSKEEEQMVIELHAMHGNK-WAKMAGYLE-GRTDNEIKNFWNT 299
                       79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.059198254IPR017930Myb domain
SuperFamilySSF466895.62E-31200297IPR009057Homeodomain-like
SMARTSM007171.8E-15202252IPR001005SANT/Myb domain
PfamPF002495.4E-16203250IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-23204257IPR009057Homeodomain-like
CDDcd001672.30E-11205250No hitNo description
PROSITE profilePS5129418.241255305IPR017930Myb domain
SMARTSM007171.6E-14255303IPR001005SANT/Myb domain
PfamPF002491.3E-13256299IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-23258303IPR009057Homeodomain-like
CDDcd001671.23E-10258299No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MRATLVLLLT LTFLLLPSDA THETCSTVVI APMGNACNQN NCEDACQAWW QRLTCEPGAE  60
CNWRSYCVAE GCSCTWCERD TPSPFHAGHS RGCSADTALS PNSEVSKAKA IASLSPQFPI  120
YRRSVWAKRL LSSGLKMEEA EKTALGLPEL PKMEIHSPPL SHSDDDDETE ADDSDGEEEE  180
GGAGVGAGGG GGGAGVGGPP LKKGPWTPDE DKRLKTYVEA HGEGNWNQVQ RNAGLNRCGK  240
SCRLRWANHL RPNLKKGPFS KEEEQMVIEL HAMHGNKWAK MAGYLEGRTD NEIKNFWNTR  300
SKRLSKAGQD LYPDGLLSWV ANQDMNCHSP DDSHGKKRQN ELSQGNGLDL DDIIFEKLDY  360
KKTENYLAPF YTDPLTVDAM NPLKCQASSS SIGAGYNGSL TCEPFPEQPE KTHNSIDMNS  420
GIIKNQFASS SPILHSSFST PGTFQRPMKI ELPSFQCHTE VNGPSSCQIQ PASEYDDTLV  480
YFPKPDLLQS QYLPSQNNGS MDFMVQAGHG PGDHSMPQGS FSSTFGVNLH ESGSLVVFRS  540
SKSPASPDAP SVDNKYYADY MSPDKYMSYS LHACRPDASP GARILSEDSS HSKYQINPCS  600
FDAPQGAGVL NEVSSRSEFQ PVNGPYDPIL FGDSFWSSTA GHDHQIELKP NWQRMPSVRH  660
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-261973031106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7309000.0EU730900.1 Brachypodium distachyon clone BAC DH003L20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563657.20.0PREDICTED: transcription factor GAMYB-like
RefseqXP_010227543.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0Q3H4J10.0A0A0Q3H4J1_BRADI; Uncharacterized protein
STRINGBRADI1G36540.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129022331
Representative plantOGRP1067739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.12e-53myb domain protein 65